PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 429aa    MW: 48518.1 Da    PI: 5.1892
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05659genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.51.1e-11249295147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+ WT+eE++ ++ + + +G g+Wk I++++ ++ t+ ++ s+ qk+
         EMT05659 249 RKFWTKEEHKSFLYGLEVYGRGDWKNISKHFVTTQTPVHVSSHAQKF 295
                      678******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.27244300IPR017930Myb domain
SuperFamilySSF466892.94E-15246301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-8247300IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-13248298IPR006447Myb domain, plants
SMARTSM007174.4E-7248298IPR001005SANT/Myb domain
CDDcd001674.01E-6252281No hitNo description
PfamPF002492.3E-7252294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MDPIVNQGWT SSEVEEAYSL IASLNTNKIM YDDNDDKNKK QHYIVNSLHA LFHSKTMKQQ  60
REGTNVTGGS PQNIFTFCDP VNGNYELPKE ENGASSTHSV YTMGDHANEN FGVREKETTI  120
MDNNGLSFGC AVEDMRITVT GEALLMADNN KMKVLENNIS IDQPIVAPHQ WGFWTDEEHS  180
MGGLVNEDIE VQEGEEMTMD DSGFSFHCTL EDTRIRKMEE APVMVDKNKM VVLENNSSND  240
RPVVAQHQRK FWTKEEHKSF LYGLEVYGRG DWKNISKHFV TTQTPVHVSS HAQKFFKRIE  300
KKASSGIKRY SINDVRLHDN ELLAANNSSA PRQTLSFTSL NNDPSFRLQA PTSSFAVMNN  360
LAQCSPSIYN QQVGQQPMWR EQQMMGSTAA VMGRVGNYVP DGQQGSAYFY LAMYEQDVVD  420
RRLGPCLEC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8AW580.0M8AW58_AEGTA; Myb-like protein J
STRINGMLOC_10707.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.27e-19MYB_related family protein